ST1C2_RAT   Q9WUW8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9WUW8

Recommended name:Sulfotransferase 1C2

EC number:EC:2.8.2.1

Alternative names:ST1C2; rSULT1C2

Cleaved into:

GeneID:171072

Gene names  (primary ):Sult1c2

Gene names  (synonym ):Sultk1

Gene names  (ORF ):

Length:296

Mass:34,731

Sequence:MALAPELSRQTKLKEVAGIPLQAPTVDNWSQIQTFKAKPDDLLICTYPKSGTTWIQEIVDMIEQNGDVEKCQRTIIQHRHPFIEWARPPQPSGVDKANAMPAPRILRTHLPTQLLPPSFWTNNCKFLYVARNAKDCMVSYYHFYRMSQVLPDPGTWNEYFETFINGKVSWGSWFDHVKGWWEIRDRYQILFLFYEDMKRDPKREIQKVMQFMGKNLDEEVVDKIVLETSFEKMKENPMTNRSTVPKSVLDQSISPFMRKGTVGDWKNHFTVAQNDRFDEIYKQKMGGTSLNFCMEL

Tissue specificity:Highly expressed in kidney and at lower levels in stomach and liver. More specifically found in the epithelia of proximal tubules of the kidney, of the bile duct, of the gastric mucosa, and in hepatocytes. 1

Induction:

Developmental stage:Down-regulated in kidney but not in stomach following feeding with 2-amino-4,5-diphenylthiazole. 1

Protein families:


   💬 WhatsApp