SIAH1_RAT   Q920M9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q920M9

Recommended name:E3 ubiquitin-protein ligase SIAH1

EC number:EC:2.3.2.27

Alternative names:RING-type E3 ubiquitin transferase SIAH1 Curated Seven in absentia homolog 1 (Siah-1) Siah-1a

Cleaved into:

GeneID:140941

Gene names  (primary ):Siah1

Gene names  (synonym ):Siah1a

Gene names  (ORF ):

Length:282

Mass:31,137

Sequence:MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp