KCIP1_RAT Q8R426
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R426
Recommended name：A-type potassium channel modulatory protein KCNIP1 Curated
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Kcnip1
Gene names (synonym )：Kchip1 1 Publication
Gene names (ORF )：
Length：227
Mass：26,817
Sequence：MGAVMGTFSSLQTKQRRPSKDIAWWYYQYQRDKIEDDLEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEETFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM
Tissue specificity：Detected in hippocampus and in the molecular layer of the dentate gyrus (at protein level) (PubMed:15356203). Isoform 1 and isoform 2 are predominantly expressed at equal levels in brain. Colocalizes with KCND3 in inhibitory interneurons in cortex and hippocampus and in striatal interneurons. 3 s
Induction：
Developmental stage：
Protein families：