S36A2_RAT Q8K415
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8K415
Recommended name：Proton-coupled amino acid transporter 2
EC number：
Alternative names：Solute carrier family 36 member 2 Imported Transmembrane domain rich protein 1 1 Publication (Tramdorin-1 1 Publication)
Cleaved into：
GeneID：246235
Gene names (primary )：Slc36a2
Gene names (synonym )：Pat2 1 Publication, Tramd1 1 Publication
Gene names (ORF )：
Length：481
Mass：52,278
Sequence：MSVTKSAGSPQVAATVKLDLVSFPESAKKVQSQDPNPVNGSSSESSEKTKGITGFQTLVHLVKGNMGTGILGLPLAVKNAGILMGPLSLLVMGLIACHCMHILVRCAQRFCHRLNKPFMDYGDTVMHGLASSPNTWLQSHAHWGRHAVSFFLIVTQLGFCCVYIVFLADNLKQVVEAVNSTTISCHKNETVVLTPTIDSRLYMLAFLPVLGLLVFIRNLRVLTIFSLLANVSMLVSLVIIGQYIIQGIPDPSQLPLVASWKTYPLFFGTAIFSFESIGVVLPLENKMKDARRFPTILSLGMSIITTLYIAIGALGYLRFGDDIKASITLNLPNCWLYQSVKLLYVVGILCTHALQFYVPAEIIIPLAVSQVSKRWALPVDLSIRLALVCVTCMLAILIPRLDLVLSLVGSVSSSALALIIPPLLEVTTYYGEGMSPLTITKDALISILGFMGFVVGTYQALDELIRSGNSLPLSNSTMFIQ
Tissue specificity：Expressed in lung and spleen, and to a lower extent in brain, heart, kidney and skeletal muscle. 1
Induction：
Developmental stage：
Protein families：