AB17B_RAT   Q6AY17


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6AY17

Recommended name:Alpha/beta hydrolase domain-containing protein 17B Curated

EC number:EC:3.1.2.22

Alternative names:Abhydrolase domain-containing protein 17B Imported

Cleaved into:

GeneID:309399

Gene names  (primary ):Abhd17b

Gene names  (synonym ):

Gene names  (ORF ):

Length:288

Mass:32,201

Sequence:MNNLSFSELCCLFCCPPCPGKIASKLAFLPPDPTYTLMCDESGSRWTLHLSERADWQYSSREKDAIECFMTRTSKGNRIACMFVRCSPNAKYTLLFSHGNAVDLGQMSSFYIGLGSRINCNIFSYDYSGYGASSGKPTEKNLYADVEAAWLALRTRYGIRPENVIIYGQSIGTVPSVDLAARYESAAVILHSPLTSGMRVAFPDTKKTYCFDAFPNIDKISKITSPVLIIHGTEDEVIDFSHGLALFERCQRPVEPLWVEGAGHNDVELYGQYLERLKQFVSQELVNL

Tissue specificity:Expressed in brain (at protein level). 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp