ECH1_RAT Q62651
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62651
Recommended name：Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial Curated
EC number：EC:5.3.3.-
Alternative names：
Cleaved into：
GeneID：64526
Gene names (primary )：Ech1
Gene names (synonym )：
Gene names (ORF )：
Length：327
Mass：36,172
Sequence：MATAMTVSSKLLGLLMQQLRGTRQLYFNVSLRSLSSSAQEASKRIPEEVSDHNYESIQVTSAQKHVLHVQLNRPEKRNAMNRAFWRELVECFQKISKDSDCRAVVVSGAGKMFTSGIDLMDMASDILQPPGDDVARIAWYLRDLISRYQKTFTVIEKCPKPVIAAIHGGCIGGGVDLISACDIRYCTQDAFFQVKEVDVGLAADVGTLQRLPKVIGNRSLVNELTFTARKMMADEALDSGLVSRVFPDKDVMLNAAFALAADISSKSPVAVQGSKINLIYSRDHSVDESLDYMATWNMSMLQTQDIIKSVQAAMEKKDSKSITFSKL
Tissue specificity：Expressed in heart and liver (at protein level). 2 s
Induction：
Developmental stage：
Protein families：