A1AG_RAT P02764
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P02764
Recommended name：Alpha-1-acid glycoprotein
EC number：
Alternative names：
Cleaved into：
GeneID：24614
Gene names (primary )：Orm1
Gene names (synonym )：
Gene names (ORF )：
Length：205
Mass：23,575
Sequence：MALHMVLVVLSLLPLLEAQNPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQTEYFYLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHLIVLKKHGTFMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTKDKCSEQQKQQLELEKETKKETKKDP
Tissue specificity：Alpha-1-AGP is synthesized in the liver, the synthesis being controlled by glucocorticoids, interleukin-1 and interleukin-6, it increases 5- to 50-fold upon inflammation.
Induction：
Developmental stage：
Protein families：calycin superfamily