PTN7_RAT   P49445


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P49445

Recommended name:Tyrosine-protein phosphatase non-receptor type 7

EC number:EC:3.1.3.48

Alternative names:Hematopoietic protein-tyrosine phosphatase (HEPTP) Protein-tyrosine phosphatase LC-PTP

Cleaved into:

GeneID:246781

Gene names  (primary ):Ptpn7

Gene names  (synonym ):Lcptp

Gene names  (ORF ):

Length:359

Mass:40,314

Sequence:MVQACEGRSRAQLPTLSLGADMTQPPPAKAPAKKHVRLQERRGSSVALMLDVRSLGTVEPICSVNTPREVTLHFLRTAGHPLTRWTLQHQPPSPKQLEEEFLKIPSNFVNPEDLDIPGHASKDRYKTILPNPQSRVCLGRAHSQEDSDYINANYIRGYDGKEKVYIATQGPMPNTVADFWEMVWQEDVSLIVMLTQLREGKEKCVHYWPTEEEAYGPFQIRIQGMKEHPEYTVRHLTIQHQQECRSVKHILFSAWPDHQTPESAGPLLRLVAEVETPETAANSGPIVVHCSAGIGRTGCFIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAAQLPPETDP

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp