CD9_RAT P40241
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P40241
Recommended name：CD9 antigen 1 Publication
EC number：
Alternative names：
Cleaved into：
GeneID：24936
Gene names (primary )：Cd9 1 Publication
Gene names (synonym )：
Gene names (ORF )：
Length：226
Mass：25,215
Sequence：MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNHSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRNKDEPQRETLKAIHMALNCCGIAGGVEQFISDICPKKQVLESFQVKSCPDAIDEVFHSKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV
Tissue specificity：Expressed in the peripheral nervous system. 1
Induction：
Developmental stage：
Protein families：