RB27A_RAT P23640
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P23640
Recommended name：Ras-related protein Rab-27A
EC number：EC:3.6.5.2
Alternative names：Rab-27
Cleaved into：
GeneID：50645
Gene names (primary )：Rab27a
Gene names (synonym )：Rab27
Gene names (ORF )：
Length：221
Mass：25,068
Sequence：MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRANGPDGTVGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRAVKEEEARELAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHTSTDQLSEEKEKGLCGC
Tissue specificity：High levels in eye, intestine, lung, pancreas and spleen, and low or absent in brain, liver, heart, kidney, and skeletal muscle.
Induction：
Developmental stage：
Protein families：