SRPX2_RAT   B5DF94


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:B5DF94

Recommended name:Sushi repeat-containing protein SRPX2 1 Publication

EC number:

Alternative names:

Cleaved into:

GeneID:317181

Gene names  (primary ):Srpx2

Gene names  (synonym ):

Gene names  (ORF ):

Length:466

Mass:52,853

Sequence:MKTGSLTQRGALLLLLLLAPAVTPTWYAGSGYSPDESYNEVYAEEVPDTRALDYRVPRWCYTLNIQDGEATCYSPRGGNYHSSLGTRCELSCDRGFRLIGRKSVQCLPSRRWSGTAYCRQMRCHTLPFITSGTYTCTNGMLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKIAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPILKPPQHGYLTCSSAGDNYGAICEYHCDGGYERQGTPSRVCQSSRQWSGSPPVCTPMKINVNVNSAAGLLDQFYEKQRLLIVSAPDPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSAGIIEELRQFQRLTRSYFNMVLIDKQGIDRERYMEPVTPEEIFTFIDDYLLSNQELARRAEQRDVCE

Tissue specificity:Expressed at higher levels in the cerebral cortex of juveniles than adults (at protein level). 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp