DTBP1_RAT Q5M834
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5M834
Recommended name：Dysbindin
EC number：
Alternative names：
Cleaved into：
GeneID：641528
Gene names (primary )：Dtnbp1
Gene names (synonym )：Bloc1s8
Gene names (ORF )：
Length：352
Mass：39,742
Sequence：MLETLRERLLSVQQDFTSGLKTLSDKSKEAKVKSRPRTAPYLPKYSAGLDLLSRYEDTWAALHRRAKECADAGELVDSEVVMLSAHWEKKRTSLAELQEQLQQLPALLQDVESLMASLAHLETSFEEVENHLLHLEDLCGQCELERHKQAHARHLEDYKKSKRKELEAFKAELDTEHAQKILEMEHTQQLKLKERQKFFEEAFQQDMEQYLSTGHLQIAERREPMGSMSSMEVNVDVLEQMDLMDLSDQEALDVFLNSGGEDNTVISPGLEMESNPSQNEMNLQIPNPSESASQPPASPSACTDLDTADAPLIQADEEEVQVDTALVTLNTDRKSTPGVSDDSDQCDSTQDI
Tissue specificity：Detected in hippocampus neurons (at protein level). Ubiquitously expressed. The highest expression is observed in testis, liver, kidney, brain, heart and lung. In the brain, found primarily in axon bundles and axon terminals, notably in the cerebellum and hippocampus. Expressed at lower levels in stomach, small intestine and skeletal muscle, where it is detected at the sarcolemma. 3 s
Induction：
Developmental stage：
Protein families：