TEBP_RAT   P83868


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P83868

Recommended name:Prostaglandin E synthase 3

EC number:EC:5.3.99.3

Alternative names:Cytosolic prostaglandin E2 synthase (cPGES) Hsp90 co-chaperone Progesterone receptor complex p23 Telomerase-binding protein p23

Cleaved into:

GeneID:362809

Gene names  (primary ):Ptges3 By Similarity

Gene names  (synonym ):Tebp By Similarity

Gene names  (ORF ):

Length:160

Mass:18,721

Sequence:MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMDHMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE

Tissue specificity:Widely expressed with highest levels in testis. 1

Induction:

Developmental stage:In brain, by LPS. 1

Protein families:


   💬 WhatsApp