RING1_RAT   Q6MGB6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6MGB6

Recommended name:E3 ubiquitin-protein ligase RING1

EC number:EC:2.3.2.27

Alternative names:Polycomb complex protein RING1 RING finger protein 1 RING-type E3 ubiquitin transferase RING1 Curated

Cleaved into:

GeneID:

Gene names  (primary ):Ring1

Gene names  (synonym ):Rnf1

Gene names  (ORF ):

Length:406

Mass:42,661

Sequence:MTTPANAQNASKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPMPGSDQTTTMSGGEGEPGEGEGDGEDISSDSAPDSAPGPAPKRPRGGGAGGSSVGTGGGAAGGACGGAGSEDSGDRGGTLGGGTLGPPSPPGAPSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNATVDHLSKYLALRIALERRQQQETVEPGGPGGGASDTGGPDGGGGERGVSGGGEGPEEPALPSLEGVSEKQYTIYIAPGGGAFTTLNGSLTLELVNEKFWKVSRPLELCYAPTKDPK

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp