MGAT2_RAT Q09326
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q09326
Recommended name：Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
EC number：EC:2.4.1.143
Alternative names：Beta-1,2-N-acetylglucosaminyltransferase II 1 Publication GlcNAc-T II (GNT-II) Mannoside acetylglucosaminyltransferase 2 N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase II
Cleaved into：
GeneID：94273
Gene names (primary )：Mgat2
Gene names (synonym )：Gnt2
Gene names (ORF )：
Length：442
Mass：51,110
Sequence：MRFRIYKRKVLILTLVVAACGFVLWSSNGRQRKNDALAPPLLDSEPLRGAGHFAASVGIRRVSNDSAAPLVPAVPRPEVDNLTLRYRSLVYQLNFDQMLRNVDKDGTWSPGELVLVVQVHNRPEYLRLLIDSLRKAQGIREVLVIFSHDFWSAEINSLISSVDFCPVLQVFFPFSIQLYPSEFPGSDPRDCPRDLKKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHFVWERVKVLQDYTGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPGCDVLSLGTYTTIRSFYGIADKVDVKTWKSTEHNMGLALTRDAYQKLIECTDTFCTYDDYNWDWTLQYLTLACLPKVWKVLVPQAPRIFHAGDCGMHHKKTCRPSTQSAQIESLLNNNKQYLFPETLVIGEKFPMAAISPPRKNGGWGDIRDHELCKSYRRLQ
Tissue specificity：Detected in liver (at protein level). Detected in liver, brain, thymus and spleen. 1
Induction：
Developmental stage：
Protein families：