SCN1B_RAT Q00954
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q00954
Recommended name:Sodium channel regulatory subunit beta-1 1 Publication
EC number:
Alternative names:
Cleaved into:
GeneID:29686
Gene names (primary ):Scn1b
Gene names (synonym ):
Gene names (ORF ):
Length:218
Mass:24,692
Sequence:MGTLLALVVGAVLVSSAWGGCVEVDSETEAVYGMTFKILCISCKRRSETTAETFTEWTFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIFITNVTYNHSGDYECHVYRLLFFDNYEHNTSVVKKIHLEVVDKANRDMASIVSEIMMYVLIVVLTIWLVAEMVYCYKKIAAATEAAAQENASEYLAITSESKENCTGVQVAE
Tissue specificity:Detected in brain (at protein level) (PubMed:11470829). Expressed in brain, heart, skeletal muscle and spinal cord (PubMed:1375395, PubMed:8282123). 3 s
Induction:
Developmental stage:In developing nodes of Ranvier, it is localized in the sciatic nerve at postnatal days 3 and 10, during the process of myelination and maturation of the nodes. 1
Protein families: