3BHS1_RAT P22071
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P22071
Recommended name：3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1
EC number：
Alternative names：
Cleaved into：
GeneID：360348
Gene names (primary )：Hsd3b1
Gene names (synonym )：
Gene names (ORF )：
Length：373
Mass：42,037
Sequence：MPGWSCLVTGAGGFVGQRIIRMLVQEKELQEVRALDKVFRPETKEEFSKLQTKAKVTMLEGDILDAQYLRRACQGISVVIHTAAVIDVSHVLPRQTILDVNLKGTQNILEACVEASVPAFIYCSTVDVAGPNSYKKIILNGHEEEHHESTWSDAYPYSKRMAEKAVLAANGSILKNGGTLHTCALRPMYIYGERSPFLSVMILAALKNKGILNVTGKFSIANPVYVGNVAWAHILAARGLRDPKKSQNVQGQFYYISDDTPHQSYDDLNCTLSKEWGLRLDSSWSLPLPLLYWLAFLLETVSFLLRPFYNYRPPFNCHLVTLSNSKFTFSYKKAQRDLGYVPLVSWEEAKQKTSEWIGTLVEQHRETLDTKSQ
Tissue specificity：Adrenal glands, kidney, testes and ovaries. 1
Induction：
Developmental stage：
Protein families：