ATP5J_RAT P21571
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P21571
Recommended name：ATP synthase peripheral stalk subunit F6, mitochondrial Curated
EC number：
Alternative names：ATP synthase peripheral stalk subunit F6 Curated
Cleaved into：
GeneID：94271
Gene names (primary )：Atp5pf
Gene names (synonym )：Atp5j
Gene names (ORF )：
Length：108
Mass：12,494
Sequence：MTVQRIFRLSSVLRSAVSVHLRRNIGVTAVAFNKELDPVQKLFLDKIREYKAKRLASGGPVDTGPEYQQEVDRELFKLKQMYGKGEMDKFPTFNFEDPKFEVLDKPQS
Tissue specificity：
Induction：
Developmental stage：
Protein families：