PATE1_HUMAN   Q8WXA2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8WXA2

Recommended name:Prostate and testis expressed protein 1

EC number:

Alternative names:

Cleaved into:

GeneID:160065

Gene names  (primary ):PATE1

Gene names  (synonym ):PATE

Gene names  (ORF ):

Length:126

Mass:14271

Sequence:MDKSLLLELPILLCCFRALSGSLSMRNDAVNEIVAVKNNFPVIEIVQCRMCHLQFPGEKCSRGRGICTATTEEACMVGRMFKRDGNPWLTFMGCLKNCADVKGIRWSVYLVNFRCCRSHDLCNEDL

Tissue specificity:Expressed specifically in prostate cancer, normal prostate, and testis. Expressed in the epithelial cells of the prostate cancer and normal prostate tissues. {ECO:0000269|PubMed:11880645}.

Induction:

Developmental stage:

Protein families:PATE family


   💬 WhatsApp