TAFA5_HUMAN Q7Z5A7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q7Z5A7
Recommended name：Chemokine-like protein TAFA-5
EC number：
Alternative names：
Cleaved into：
GeneID：25817
Gene names (primary )：TAFA5
Gene names (synonym )：FAM19A5
Gene names (ORF )：UNQ5208/PRO34524
Length：132
Mass：14301
Sequence：MAPSPRTGSRQDATALPSMSSTFWAFMILASLLIAYCSQLAAGTCEIVTLDRDSSQPRRTIARQTARCACRKGQIAGTTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLINRSGWTCTQPGGRIKTTTVS
Tissue specificity：Expressed in the subcutaneous and perirenal adipose tissue (at protein level) (PubMed:29453251). Highly expressed in adipose tissue with moderate expression in the brain and ovary (PubMed:29453251). Isoform 2: Brain-specific (PubMed:15028294). {ECO:0000269|PubMed:15028294, ECO:0000269|PubMed:29453251}.
Induction：
Developmental stage：
Protein families：TAFA family