SPEF1_HUMAN   Q9Y4P9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Y4P9

Recommended name:Sperm flagellar protein 1

EC number:

Alternative names:

Cleaved into:

GeneID:25876

Gene names  (primary ):SPEF1

Gene names  (synonym ):C20orf28

Gene names  (ORF ):

Length:236

Mass:26987

Sequence:MASSVDEEALHQLYLWVDNIPLSRPKRNLSRDFSDGVLVAEVIKFYFPKMVEMHNYVPANSLQQKLSNWGHLNRKVLKRLNFSVPDDVMRKIAQCAPGVVELVLIPLRQRLEERQRRRKQGAGSLQELAPQDGSGYMDVGVSQKARGEGVPDPQGGGQLSWDRPPAPRPPAYNRALQGDPSFVLQIAEKEQELLASQETVQVLQMKVRRLEHLLQLKNVRIEDLSRRLQQAERKQR

Tissue specificity:Expressed in the intestinal epithelial cells (at protein level). {ECO:0000269|PubMed:31473225}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp