XAGE2_HUMAN   Q96GT9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96GT9

Recommended name:X antigen family member 2

EC number:

Alternative names:(XAGE-2) (Cancer/testis antigen 12.2) (CT12.2) (G antigen family D member 3)

Cleaved into:

GeneID:9502

Gene names  (primary ):XAGE2

Gene names  (synonym ):GAGED3 XAGE2B

Gene names  (ORF ):

Length:111

Mass:12354

Sequence:MSWRGRSTYRPRPRRSLQPPELIGAMLEPTDEEPKEEKPPTKSRNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV

Tissue specificity:

Induction:

Developmental stage:

Protein families:GAGE family


   💬 WhatsApp