MPLKI_HUMAN   Q8TAP9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8TAP9

Recommended name:M-phase-specific PLK1-interacting protein

EC number:

Alternative names:(TTD non-photosensitive 1 protein)

Cleaved into:

GeneID:136647

Gene names  (primary ):MPLKIP

Gene names  (synonym ):C7orf11 TTDN1

Gene names  (ORF ):

Length:179

Mass:19147

Sequence:MQRQNFRPPTPPYPGPGGGGWGSGSSFRGTPGGGGPRPPSPRDGYGSPHHTPPYGPRSRPYGSSHSPRHGGSFPGGRFGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVREKRMSNELENYFKPSMLEDPWAGLEPVSVVDISQQYSNTQTFTGKKGRYFC

Tissue specificity:Expressed at highest levels in liver and kidney; intermediate expression in skeletal muscle, pancreas, heart and placenta; low expression in brain and lung. Expressed in epidermis and hair follicles. {ECO:0000269|PubMed:11829489, ECO:0000269|PubMed:15645389}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp