T126B_HUMAN   Q8IUX1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8IUX1

Recommended name:Complex I assembly factor TMEM126B, mitochondrial

EC number:

Alternative names:(Transmembrane protein 126B)

Cleaved into:

GeneID:55863

Gene names  (primary ):TMEM126B

Gene names  (synonym ):

Gene names  (ORF ):HT007

Length:230

Mass:25943

Sequence:MVVFGYEAGTKPRDSGVVPVGTEEAPKVFKMAASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQNIYQMATFGTTAGFSGIFSNFLFRRCFKVKHDALKTYASLATLPFLSTVVTDKLFVIDALYSDNISKENCVFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLCQTQMKLMAIPLVFQIMFGILNGLYHYAVFEETLEKTIHEE

Tissue specificity:

Induction:

Developmental stage:

Protein families:TMEM126 family


   💬 WhatsApp