CD28_HUMAN P10747
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P10747
Recommended name：T-cell-specific surface glycoprotein CD28
EC number：
Alternative names：(TP44) (CD antigen CD28)
Cleaved into：
GeneID：940
Gene names (primary )：CD28
Gene names (synonym )：
Gene names (ORF )：
Length：220
Mass：25066
Sequence：MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Tissue specificity：Expressed in T-cells and plasma cells, but not in less mature B-cells.
Induction：
Developmental stage：
Protein families：