SUMO5_HUMAN   G2XKQ0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:G2XKQ0

Recommended name:Small ubiquitin-related modifier 5

EC number:

Alternative names:(SUMO-5) (SUMO1 pseudogene 1) (Ubiquitin-like 2) (Ubiquitin-like 6)

Cleaved into:

GeneID:

Gene names  (primary ):SUMO1P1

Gene names  (synonym ):SUMO5 UBL2 UBL6

Gene names  (ORF ):

Length:101

Mass:11526

Sequence:MSDLEAKPSTEHLGDKIKDEDIKLRVIGQDSSEIHFKVKMTTPLKKLKKSYCQRQGVPVNSLRFLFEGQRIADNHTPEELGMEEEDVIEVYQEQIGGHSTV

Tissue specificity:High expression levels in testes and peripheral blood leukocyte (PubMed:27211601). Expressed also in lung, placenta, liver, spleen and thymus (PubMed:27211601). {ECO:0000269|PubMed:27211601}.

Induction:

Developmental stage:

Protein families:Ubiquitin family, SUMO subfamily


   💬 WhatsApp