TSAP1_HUMAN   Q9NX07


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NX07

Recommended name:tRNA selenocysteine 1-associated protein 1

EC number:EC:43

Alternative names:(SECp43) (tRNA selenocysteine-associated protein 1)

Cleaved into:

GeneID:54952

Gene names  (primary ):TRNAU1AP

Gene names  (synonym ):SECP43 TRSPAP1

Gene names  (ORF ):

Length:287

Mass:32499

Sequence:MAASLWMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFADLATAEKCLHKINGKPLPGATPAKRFKLNYATYGKQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLDQTGVSKGYGFVKFTDELEQKRALTECQGAVGLGSKPVRLSVAIPKASRVKPVEYSQMYSYSYNQYYQQYQNYYAQWGYDQNTGSYSYSYPQYGYTQSTMQTYEEVGDDALEDPMPQLDVTEANKEFMEQSEELYDALMDCHWQPLDTVSSEIPAMM

Tissue specificity:

Induction:

Developmental stage:

Protein families:RRM TRSPAP family


   💬 WhatsApp