RNAS8_HUMAN   Q8TDE3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8TDE3

Recommended name:Ribonuclease 8

EC number:EC:3.1.27.-

Alternative names:(RNase 8)

Cleaved into:

GeneID:122665

Gene names  (primary ):RNASE8

Gene names  (synonym ):

Gene names  (ORF ):

Length:154

Mass:17041

Sequence:MAPARAGCCPLLLLLLGLWVAEVLVRAKPKDMTSSQWFKTQHVQPSPQACNSAMSIINKYTERCKDLNTFLHEPFSSVAITCQTPNIACKNSCKNCHQSHGPMSLTMGELTSGKYPNCRYKEKHLNTPYIVACDPPQQGDPGYPLVPVHLDKVV

Tissue specificity:Expressed prominently in the placenta and is not detected in any other tissues examined.

Induction:

Developmental stage:

Protein families:Pancreatic ribonuclease family


   💬 WhatsApp