TMM11_HUMAN P17152
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P17152
Recommended name：Transmembrane protein 11, mitochondrial
EC number：
Alternative names：(Protein PM1) (Protein PMI)
Cleaved into：
GeneID：8834
Gene names (primary )：TMEM11
Gene names (synonym )：C17orf35 PM1
Gene names (ORF )：
Length：192
Mass：21541
Sequence：MAAWGRRRLGPGSSGGSARERVSLSATDCYIVHEIYNGENAQDQFEYELEQALEAQYKYIVIEPTRIGDETARWITVGNCLHKTAVLAGTACLFTPLALPLDYSHYISLPAGVLSLACCTLYGISWQFDPCCKYQVEYDAYKLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIALAALVYCVKKIYELYAV
Tissue specificity：
Induction：
Developmental stage：
Protein families：TMEM11 family