SERF1_HUMAN O75920
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O75920
Recommended name：Small EDRK-rich factor 1
EC number：
Alternative names：(Protein 4F5) (h4F5) (SMA modifier 1)
Cleaved into：
GeneID：728492
Gene names (primary )：SERF1A; SERF1B
Gene names (synonym )：FAM2A SERF1 SMAM1; FAM2B SERF1 SMAM1
Gene names (ORF )：;
Length：110
Mass：12349
Sequence：MARGNQRELARQKNMKKTQEISKGKRKEDSLTASQRKQSSGGQKSESKMSAGPHLPLKAPRENPCFPLPAAGGSRYYLAYGSITPISAFVFVVFFSVFFPSFYEDFCCWI
Tissue specificity：Isoform Long is predominantly expressed in heart, brain and skeletal muscle. Isoform Short and Isoform Long are expressed throughout the central nervous system, including spinal cord. {ECO:0000269|PubMed:9731538}.
Induction：
Developmental stage：
Protein families：SERF family