PGSF1_HUMAN   Q8N6C7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8N6C7

Recommended name:Putative uncharacterized protein encoded by MIR7-3HG

EC number:

Alternative names:(Pituitary gland-specific factor 1)

Cleaved into:

GeneID:

Gene names  (primary ):MIR7-3HG

Gene names  (synonym ):C19orf30 LINC00306 NCRNA00306 PGSF1

Gene names  (ORF ):

Length:128

Mass:14321

Sequence:MPGMRLVCRLAHGHFPRKGQRRRSLTVWKAETSRADCLGAPNIRTAPLGRSEKRTAICFSTGAQDSSQRAPFRLQNPGQLLQLGMHSLHLHPELPTTDPAFFCKLHFIKGNDPYCLTISHVKSVLTFS

Tissue specificity:High expression in pituitary gland and weak in pancreas. {ECO:0000269|PubMed:11854097}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp