DAAF6_HUMAN   Q9NQM4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NQM4

Recommended name:Dynein assembly factor 6, axonemal

EC number:

Alternative names:(PIH1 domain-containing protein 3) (Sarcoma antigen NY-SAR-97)

Cleaved into:

GeneID:139212

Gene names  (primary ):DNAAF6

Gene names  (synonym ):CXorf41 PIH1D3

Gene names  (ORF ):

Length:214

Mass:24069

Sequence:MESENMDSENMKTENMESQNVDFESVSSVTALEALSKLLNPEEEDDSDYGQTNGLSTIGAMGPGNIGPPQIEELKVIPETSEENNEDIWNSEEIPEGAEYDDMWDVREIPEYEIIFRQQVGTEDIFLGLSKKDSSTGCCSELVAKIKLPNTNPSDIQIDIQETILDLRTPQKKLLITLPELVECTSAKAFYIPETETLEITMTMKRELDIANFF

Tissue specificity:Expressed in testis, small intestine, prostate, adrenal gland, spleen, lung, bladder, breast and ovary. Expressed in ciliated epithelial cells (PubMed:28176794). {ECO:0000269|PubMed:12601173, ECO:0000269|PubMed:28176794}.

Induction:

Developmental stage:

Protein families:PIH1 family


   💬 WhatsApp