NCEH1_HUMAN   Q6PIU2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6PIU2

Recommended name:Neutral cholesterol ester hydrolase 1

EC number:EC:3.1.1.-

Alternative names:(NCEH) (Arylacetamide deacetylase-like 1)

Cleaved into:

GeneID:57552

Gene names  (primary ):NCEH1

Gene names  (synonym ):AADACL1 KIAA1363

Gene names  (ORF ):

Length:408

Mass:45808

Sequence:MRSSCVLLTALVALAAYYVYIPLPGSVSDPWKLMLLDATFRGAQQVSNLIHYLGLSHHLLALNFIIVSFGKKSAWSSAQVKVTDTDFDGVEVRVFEGPPKPEEPLKRSVVYIHGGGWALASAKIRYYDELCTAMAEELNAVIVSIEYRLVPKVYFPEQIHDVVRATKYFLKPEVLQKYMVDPGRICISGDSAGGNLAAALGQQFTQDASLKNKLKLQALIYPVLQALDFNTPSYQQNVNTPILPRYVMVKYWVDYFKGNYDFVQAMIVNNHTSLDVEEAAAVRARLNWTSLLPASFTKNYKPVVQTTGNARIVQELPQLLDARSAPLIADQAVLQLLPKTYILTCEHDVLRDDGIMYAKRLESAGVEVTLDHFEDGFHGCMIFTSWPTNFSVGIRTRNSYIKWLDQNL

Tissue specificity:Expressed in monocyte-derived macrophages. Up-regulated in invasive melanoma and breast carcinoma cell lines. {ECO:0000269|PubMed:12149457, ECO:0000269|PubMed:18782767}.

Induction:

Developmental stage:

Protein families:'GDXG' lipolytic enzyme family


   💬 WhatsApp