HMHB1_HUMAN   O97980


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O97980

Recommended name:Minor histocompatibility protein HB-1 [Cleaved into: Minor histocompatibility antigen HB-1

EC number:

Alternative names:(mHag HB-1)]

Cleaved into:Minor histocompatibility antigen HB-1 (mHag HB-1)

GeneID:57824

Gene names  (primary ):HMHB1

Gene names  (synonym ):

Gene names  (ORF ):

Length:41

Mass:4965

Sequence:MEEQPECREEKRGSLHVWKSELVEVEDDVYLRHSSSLTYRL

Tissue specificity:Expressed in acute lymphoblastic leukemia B-cells and Epstein-Barr virus-transformed B-cells. {ECO:0000269|PubMed:8992968, ECO:0000269|PubMed:9892612}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp