L37A5_HUMAN   Q49AS3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q49AS3

Recommended name:Putative protein LRRC37A5P

EC number:

Alternative names:(Leucine-rich repeat-containing 37 member A5 pseudogene)

Cleaved into:

GeneID:

Gene names  (primary ):LRRC37A5P

Gene names  (synonym ):C9orf29

Gene names  (ORF ):

Length:106

Mass:12596

Sequence:MNRNILEEMLQYLLIDWIVGDQFEIQLNQQLWSLIPNNDVRRLVSHVIRTLKTDCTETHLQLACAKLISRTGLLMKLLSEQQELRTVSMTAWKPRMNRKSRSRMRS

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp