RM23_HUMAN Q16540
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q16540
Recommended name：39S ribosomal protein L23, mitochondrial
EC number：
Alternative names：(L23mt) (MRP-L23) (L23 mitochondrial-related protein) (Mitochondrial large ribosomal subunit protein uL23m) (Ribosomal protein L23-like)
Cleaved into：
GeneID：6150
Gene names (primary )：MRPL23
Gene names (synonym )：L23MRP RPL23L
Gene names (ORF )：
Length：153
Mass：17781
Sequence：MARNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTRVDLRNYLEGIYNVPVAAVRTRVQHGSNKRRDHRNVRIKKPDYKVAYVQLAHGQTFTFPDLFPEKDESPEGSAADDLYSMLEEERQQRQSSDPRRGGVPSWFGL
Tissue specificity：
Induction：
Developmental stage：
Protein families：Universal ribosomal protein uL23 family