T4S4_HUMAN P48230
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P48230
Recommended name：Transmembrane 4 L6 family member 4
EC number：
Alternative names：(Intestine and liver tetraspan membrane protein) (IL-TMP)
Cleaved into：
GeneID：7104
Gene names (primary )：TM4SF4
Gene names (synonym )：ILTMP
Gene names (ORF )：
Length：202
Mass：21396
Sequence：MCTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGGILGSGVLMIFPALVFLGLKNNDCCGCCGNEGCGKRFAMFTSTIFAVVGFLGAGYSFIISAISINKGPKCLMANSTWGYPFHDGDYLNDEALWNKCREPLNVVPWNLTLFSILLVVGGIQMVLCAIQVVNGLLGTLCGDCQCCGCCGGDGPV
Tissue specificity：Jejunum and liver.
Induction：
Developmental stage：
Protein families：L6 tetraspanin family