KV320_HUMAN P01619
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P01619
Recommended name：Immunoglobulin kappa variable 3-20
EC number：
Alternative names：(Ig kappa chain V-III region B6) (Ig kappa chain V-III region GOL) (Ig kappa chain V-III region HAH) (Ig kappa chain V-III region HIC) (Ig kappa chain V-III region IARC/BL41) (Ig kappa chain V-III region NG9) (Ig kappa chain V-III region SIE) (Ig kappa chain V-III region Ti) (Ig kappa chain V-III region WOL)
Cleaved into：
GeneID：
Gene names (primary )：IGKV3-20
Gene names (synonym )：
Gene names (ORF )：
Length：116
Mass：12557
Sequence：METPAQLLFLLLLWLPDTTGEIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSP
Tissue specificity：
Induction：
Developmental stage：
Protein families：