KVD33_HUMAN P01593
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P01593
Recommended name：Immunoglobulin kappa variable 1D-33
EC number：
Alternative names：(Ig kappa chain V-I region AG) (Ig kappa chain V-I region Bi) (Ig kappa chain V-I region Lay) (Ig kappa chain V-I region Ni) (Ig kappa chain V-I region Rei) (Ig kappa chain V-I region Roy) (Ig kappa chain V-I region Scw) (Ig kappa chain V-I region WAT)
Cleaved into：
GeneID：
Gene names (primary )：IGKV1D-33
Gene names (synonym )：
Gene names (ORF )：
Length：117
Mass：12848
Sequence：MDMRVPAQLLGLLLLWLSGARCDIQMTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYDNLP
Tissue specificity：
Induction：
Developmental stage：
Protein families：