LV211_HUMAN P01706
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P01706
Recommended name：Immunoglobulin lambda variable 2-11
EC number：
Alternative names：(Ig gamma lambda chain V-II region DOT) (Ig lambda chain V-II region BOH) (Ig lambda chain V-II region BUR) (Ig lambda chain V-II region NIG-58) (Ig lambda chain V-II region TRO) (Ig lambda chain V-II region WIN)
Cleaved into：
GeneID：
Gene names (primary )：IGLV2-11
Gene names (synonym )：
Gene names (ORF )：
Length：119
Mass：12644
Sequence：MAWALLLLSLLTQGTGSWAQSALTQPRSVSGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYDVSKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSYTFH
Tissue specificity：
Induction：
Developmental stage：
Protein families：