MIXL1_HUMAN Q9H2W2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9H2W2
Recommended name：Homeobox protein MIXL1
EC number：
Alternative names：(Homeodomain protein MIX) (hMix) (MIX1 homeobox-like protein 1) (Mix.1 homeobox-like protein)
Cleaved into：
GeneID：83881
Gene names (primary )：MIXL1
Gene names (synonym )：MIXL
Gene names (ORF )：
Length：232
Mass：24659
Sequence：MATAESRALQFAEGAAFPAYRAPHAGGALLPPPSPAAALLPAPPAGPGPATFAGFLGRDPGPAPPPPASLGSPAPPKGAAAPSASQRRKRTSFSAEQLQLLELVFRRTRYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSGKSFQPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLPEPNGVGGGISDSSSQGQNFETCSPLSEDIGSKLDSWEEHIFSAFGNF
Tissue specificity：Restricted to progenitors and secondary lymph tissues. In normal hematopoiesis, it is restricted to immature B- and T-lymphoid cells. Present in differentiating embryonic stem cells (at protein level). {ECO:0000269|PubMed:12070013, ECO:0000269|PubMed:16433620, ECO:0000269|PubMed:17303500}.
Induction：
Developmental stage：
Protein families：Paired homeobox family