HGB1A_HUMAN B2RPK0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:B2RPK0
Recommended name:Putative high mobility group protein B1-like 1
EC number:
Alternative names:(High mobility group protein B1 pseudogene 1) (Putative high mobility group protein 1-like 1) (HMG-1L1)
Cleaved into:
GeneID:
Gene names (primary ):HMGB1P1
Gene names (synonym ):HMG1L1 HMGB1L1
Gene names (ORF ):
Length:211
Mass:24238
Sequence:MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHSDASVNFSEFSNKCSERWKTMSAKEKGKFEDMAKADKTHYERQMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYHPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPGEKKAAKLKEKYEKDIAAYQAKGKPEAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEDEEDEEDDDDE
Tissue specificity:
Induction:
Developmental stage:
Protein families:HMGB family