CRYAA_HUMAN   P02489


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P02489

Recommended name:Alpha-crystallin A chain

EC number:

Alternative names:(Heat shock protein beta-4) (HspB4)

Cleaved into:Alpha-crystallin A(1-172); Alpha-crystallin A(1-168); Alpha-crystallin A(1-162)

GeneID:102724652

Gene names  (primary ):CRYAA

Gene names  (synonym ):CRYA1 HSPB4

Gene names  (ORF ):

Length:173

Mass:19909

Sequence:MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS

Tissue specificity:Expressed in eye lens. {ECO:0000269|PubMed:12356833}.

Induction:

Developmental stage:

Protein families:Small heat shock protein (HSP20) family


   💬 WhatsApp