TM50B_HUMAN P56557
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P56557
Recommended name：Transmembrane protein 50B
EC number：
Alternative names：(HCV p7-trans-regulated protein 3)
Cleaved into：
GeneID：757
Gene names (primary )：TMEM50B
Gene names (synonym )：C21orf4
Gene names (ORF )：UNQ167/PRO193
Length：158
Mass：17936
Sequence：MAGFLDNFRWPECECIDWSERRNAVASVVAGILFFTGWWIMIDAAVVYPKPEQLNHAFHTCGVFSTLAFFMINAVSNAQVRGDSYESGCLGRTGARVWLFIGFMLMFGSLIASMWILFGAYVTQNTDVYPGLAVFFQNALIFFSTLIYKFGRTEELWT
Tissue specificity：
Induction：
Developmental stage：
Protein families：UPF0220 family