H4G_HUMAN   Q99525


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99525

Recommended name:Histone H4-like protein type G

EC number:

Alternative names:(H4-clustered histone 7)

Cleaved into:

GeneID:8369

Gene names  (primary ):H4C7

Gene names  (synonym ):H4/L H4FL HIST1H4G

Gene names  (ORF ):

Length:98

Mass:11009

Sequence:MSVRGKAGKGLGKGGAKCHRKVLSDNIQGITKCTIRRLARHGGVKRILGLIYEETRRVFKVFLENVIWYAVTNTEHAKRKTVTAMAVVYVLKRQGRTL

Tissue specificity:

Induction:

Developmental stage:

Protein families:Histone H4 family


   💬 WhatsApp