H2AB2_HUMAN   P0C5Z0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P0C5Z0

Recommended name:Histone H2A-Bbd type 2/3

EC number:

Alternative names:(H2A Barr body-deficient) (H2A.Bbd)

Cleaved into:

GeneID:474381

Gene names  (primary ):H2AB2; H2AB3

Gene names  (synonym ):H2AFB2; H2ABBD H2AFB H2AFB3

Gene names  (ORF ):;

Length:115

Mass:12713

Sequence:MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVLELAGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED

Tissue specificity:Present in mature sperm. {ECO:0000269|PubMed:20008104}.

Induction:

Developmental stage:

Protein families:Histone H2A family


   💬 WhatsApp