PG12A_HUMAN   Q9BZM1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BZM1

Recommended name:Group XIIA secretory phospholipase A2

EC number:EC:3.1.1.4

Alternative names:(GXII sPLA2) (sPLA2-XII) (Phosphatidylcholine 2-acylhydrolase 12A)

Cleaved into:

GeneID:81579

Gene names  (primary ):PLA2G12A

Gene names  (synonym ):PLA2G12

Gene names  (ORF ):FKSG38 UNQ2519/PRO6012

Length:189

Mass:21067

Sequence:MALLSRPALTLLLLLMAAVVRCQEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDL

Tissue specificity:Abundantly expressed in heart, skeletal muscle, kidney, liver and pancreas.

Induction:

Developmental stage:

Protein families:Phospholipase A2 family


   💬 WhatsApp