SFRP2_HUMAN   Q96HF1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96HF1

Recommended name:Secreted frizzled-related protein 2

EC number:

Alternative names:(FRP-2) (sFRP-2) (Secreted apoptosis-related protein 1) (SARP-1)

Cleaved into:

GeneID:6423

Gene names  (primary ):SFRP2

Gene names  (synonym ):FRP2 SARP1

Gene names  (ORF ):FKSG12 UNQ361/PRO697

Length:295

Mass:33490

Sequence:MLQGPGSLLLLFLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC

Tissue specificity:Expressed in adipose tissue, heart, brain, skeletal muscle, pancreas, thymus, prostate, testis, ovary, small intestine and colon. Highest levels in adipose tissue, small intestine and colon. {ECO:0000269|PubMed:9391078, ECO:0000269|PubMed:9642118}.

Induction:

Developmental stage:

Protein families:Secreted frizzled-related protein (sFRP) family


   💬 WhatsApp