UIF_HUMAN   Q96QD9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96QD9

Recommended name:UAP56-interacting factor

EC number:

Alternative names:(Forty-two-three domain-containing protein 1) (Protein 40-2-3)

Cleaved into:

GeneID:84248

Gene names  (primary ):FYTTD1

Gene names  (synonym ):UIF

Gene names  (ORF ):

Length:318

Mass:35818

Sequence:MNRFGTRLVGATATSSPPPKARSNENLDKIDMSLDDIIKLNRKEGKKQNFPRLNRRLLQQSGAQQFRMRVRWGIQQNSGFGKTSLNRRGRVMPGKRRPNGVITGLAARKTTGIRKGISPMNRPPLSDKNIEQYFPVLKRKANLLRQNEGQRKPVAVLKRPSQLSRKNNIPANFTRSGNKLNHQKDTRQATFLFRRGLKVQAQLNTEQLLDDVVAKRTRQWRTSTTNGGILTVSIDNPGAVQCPVTQKPRLTRTAVPSFLTKREQSDVKKVPKGVPLQFDINSVGKQTGMTLNERFGILKEQRATLTYNKGGSRFVTVG

Tissue specificity:Expressed in a wide variety of cancer types. {ECO:0000269|PubMed:25662211}.

Induction:

Developmental stage:

Protein families:UIF family


   💬 WhatsApp