FHL3_HUMAN   Q13643


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q13643

Recommended name:Four and a half LIM domains protein 3

EC number:

Alternative names:(FHL-3) (Skeletal muscle LIM-protein 2) (SLIM-2)

Cleaved into:

GeneID:2275

Gene names  (primary ):FHL3

Gene names  (synonym ):SLIM2

Gene names  (ORF ):

Length:280

Mass:31192

Sequence:MSESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP

Tissue specificity:Expressed only in skeletal muscle.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp